HPA021563

POLR2A antibody from Sigma-Aldrich
POLR2, POLRA, RPB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021563
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021563, RRID:AB_1855526
Product name
Anti-POLR2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021563
Antibody type
Polyclonal
Antigen
DNA-directed RNA polymerase II subunit RPB1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYS
NIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNT
IKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQ
VNRILNDARDKTGSSAQKSLSEYN
Storage
-20C
Provider Type Product Number
- No reagents -