H00008661-A01
antibody from Abnova Corporation
Targeting: EIF3A
EIF3, eIF3-p170, eIF3-theta, EIF3S10, KIAA0139, TIF32
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008661-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008661-A01, RRID:AB_563239
- Product name
- EIF3S10 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant EIF3S10.
- Antigen sequence
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVM
KSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEG
LYQYK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Interferon-dependent engagement of eukaryotic initiation factor 4B via S6 kinase (S6K)- and ribosomal protein S6K-mediated signals.
Kroczynska B, Kaur S, Katsoulidis E, Majchrzak-Kita B, Sassano A, Kozma SC, Fish EN, Platanias LC
Molecular and cellular biology 2009 May;29(10):2865-75
Molecular and cellular biology 2009 May;29(10):2865-75
No comments: Submit comment
No validations: Submit validation data