75-313
antibody from UC Davis/NIH NeuroMab Facility
Targeting: REEP1
C2orf23, FLJ13110, SPG31, Yip2a
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 75-313 - Provider product page
- Provider
- UC Davis/NIH NeuroMab Facility
- Proper citation
- UC Davis/NIH NeuroMab Facility Cat#75-313, RRID:AB_2315913
- Product name
- anti-REEP1
- Antibody type
- Monoclonal
- Antigen
- Recombinant protein
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
amino acids 111-201 (KDRSYDALVHFGKR
GLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI
RGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASES
AGSSGTA, cytoplasmic C-terminus) of
mouse REEP1- Isotype
- IgG
- Antibody clone number
- N345/51
- Vial size
- 100 µl
- Concentration
- 1mg/ml
- Storage
- Antibodies contain 10mm azide. Store at 4°C or aliquot and store at -20°C. Avoid repeated free-thaw cycles.
Submitted references REEP1 and REEP2 proteins are preferentially expressed in neuronal and neuronal-like exocytotic tissues.
Hurt CM, Björk S, Ho VK, Gilsbach R, Hein L, Angelotti T
Brain research 2014 Jan 30;1545:12-22
Brain research 2014 Jan 30;1545:12-22
No comments: Submit comment
No validations: Submit validation data