HPA027808

ZFP69 antibody from Atlas Antibodies
FLJ16030, ZFP69A, ZKSCAN23A, ZNF642, ZSCAN54A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027808
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027808, RRID:AB_10601031
Product name
Anti-ZFP69
Provider product page
Atlas Antibodies - HPA027808
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQ
ERLYHGIMMESFMRDDIIYSTLRKVSTYDDVLERH
QETC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -