HPA054942

ZFP69 antibody from Atlas Antibodies
FLJ16030, ZFP69A, ZKSCAN23A, ZNF642, ZSCAN54A

Antibody data

Product number
HPA054942
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA054942, RRID:AB_2682644
Product name
Anti-ZFP69
Provider product page
Atlas Antibodies - HPA054942
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MRDVRQAILTHKKRVQETNKFGENIIVHSNVIIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNI
CE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -