HPA027808

ZFP69 antibody from MilliporeSigma / Merck KGaA
FLJ16030, ZFP69A, ZKSCAN23A, ZNF642, ZSCAN54A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027808
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027808, RRID:AB_10601031
Product name
Anti-ZNF642 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027808
Antibody type
Polyclonal
Antigen
zinc finger protein 642 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQ
ERLYHGIMMESFMRDDIIYSTLRKVSTYDDVLERH
QETC
Storage
-20C
Provider Type Product Number
- No reagents -