HPA015283

BRDT antibody from Sigma-Aldrich
BRD6, CT9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015283
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015283, RRID:AB_1845442
Product name
Anti-BRDT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015283
Antibody type
Polyclonal
Antigen
Bromodomain testis-specific protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVGVKERIKKGTQQNIAVSSAKEKSSPSATEKVFK
QQEIPSVFPKTSISPLNVVQGASVNSSSQTAAQVT
KGVKRKADTTTPATSAVKASSEFSPTFTEKSVALP
PIKENMPKNVLPDSQQQYN
Storage
-20C
Provider Type Product Number
- No reagents -