HPA029841

CLDND1 antibody from MilliporeSigma / Merck KGaA
C3orf4, Z38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029841
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029841, RRID:AB_10600658
Product name
Anti-CLDND1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029841
Antibody type
Polyclonal
Antigen
claudin domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVD
PGNHNSGIDLLRTYLWRC
Storage
-20C
Provider Type Product Number
- No reagents -