Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006386-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006386-M01, RRID:AB_463981
- Product name
- SDCBP monoclonal antibody (M01), clone 2C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SDCBP.
- Antigen sequence
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEA
SAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANV
AVVSGAPLQGQLVARPSSINYMVAPVTGND- Isotype
- IgG
- Antibody clone number
- 2C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Syntenin increases the invasiveness of small cell lung cancer cells by activating p38, AKT, focal adhesion kinase and SP1.
Novel role of MDA-9/syntenin in regulating urothelial cell proliferation by modulating EGFR signaling.
MDA-9/syntenin and IGFBP-2 promote angiogenesis in human melanoma.
Raf kinase inhibitor RKIP inhibits MDA-9/syntenin-mediated metastasis in melanoma.
Systematic proteomic analysis of human hepotacellular carcinoma cells reveals molecular pathways and networks involved in metastasis.
Kim WY, Jang JY, Jeon YK, Chung DH, Kim YG, Kim CW
Experimental & molecular medicine 2014 Apr 11;46:e90
Experimental & molecular medicine 2014 Apr 11;46:e90
Novel role of MDA-9/syntenin in regulating urothelial cell proliferation by modulating EGFR signaling.
Dasgupta S, Menezes ME, Das SK, Emdad L, Janjic A, Bhatia S, Mukhopadhyay ND, Shao C, Sarkar D, Fisher PB
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Sep 1;19(17):4621-33
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Sep 1;19(17):4621-33
MDA-9/syntenin and IGFBP-2 promote angiogenesis in human melanoma.
Das SK, Bhutia SK, Azab B, Kegelman TP, Peachy L, Santhekadur PK, Dasgupta S, Dash R, Dent P, Grant S, Emdad L, Pellecchia M, Sarkar D, Fisher PB
Cancer research 2013 Jan 15;73(2):844-54
Cancer research 2013 Jan 15;73(2):844-54
Raf kinase inhibitor RKIP inhibits MDA-9/syntenin-mediated metastasis in melanoma.
Das SK, Bhutia SK, Sokhi UK, Azab B, Su ZZ, Boukerche H, Anwar T, Moen EL, Chatterjee D, Pellecchia M, Sarkar D, Fisher PB
Cancer research 2012 Dec 1;72(23):6217-26
Cancer research 2012 Dec 1;72(23):6217-26
Systematic proteomic analysis of human hepotacellular carcinoma cells reveals molecular pathways and networks involved in metastasis.
Yu Y, Shen H, Yu H, Zhong F, Zhang Y, Zhang C, Zhao J, Li H, Chen J, Liu Y, Yang P
Molecular bioSystems 2011 Jun;7(6):1908-16
Molecular bioSystems 2011 Jun;7(6):1908-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SDCBP monoclonal antibody (M01), clone 2C12 Western Blot analysis of SDCBP expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP monoclonal antibody (M01), clone 2C12.Lane 1: SDCBP transfected lysate(32.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SDCBP is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SDCBP on HepG2 cell. [antibody concentration 35 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SDCBP transfected lysate using anti-SDCBP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SDCBP MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SDCBP on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol