HPA029686

PDSS2 antibody from MilliporeSigma / Merck KGaA
bA59I9.3, C6orf210, COQ1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029686
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029686, RRID:AB_10602309
Product name
Anti-PDSS2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029686
Antibody type
Polyclonal
Antigen
prenyl (decaprenyl) diphosphate synthase, subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDFLLANACNGLALLQNTKVVELLASALMDLVQGV
YHENSTSKESYITDDIGISTWKEQTFLSHGALLAK
SCQAAMELAKHDAEVQNMAFQYGKH
Storage
-20C
Provider Type Product Number
- No reagents -