HPA005728

HIVEP3 antibody from Sigma-Aldrich
FLJ16752, KBP-1, KBP1, KIAA1555, KRC, Schnurri-3, SHN3, ZAS3, ZNF40C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005728
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005728, RRID:AB_10612117
Product name
Anti-HIVEP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005728
Antibody type
Polyclonal
Antigen
human immunodeficiency virus type I enhancer binding protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIE
LPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELT
KKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKY
YCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMM
HYKLGTTL
Storage
-20C
Provider Type Product Number
- No reagents -