H00011231-M04

SEC63 antibody from Abnova Corporation
DNAJC23, ERdj2, PRO2507, SEC63L

Antibody data

Product number
H00011231-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011231-M04, RRID:AB_1204951
Product name
SEC63 monoclonal antibody (M04), clone 1A8
Provider product page
Abnova Corporation - H00011231-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SEC63.
Antigen sequence
KSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLIS
MPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS
DSYMGLDQIKPLKLEVHEAKPVPENHPQ
Isotype
IgG
Antibody clone number
1A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -