Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310860 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SEC63 Homolog (S. Cerevisiae) (SEC63) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SEC63 antibody: synthetic peptide directed towards the C terminal of human SEC63
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPA
PGKPG NYQYTVFLRS- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
No comments: Submit comment
No validations: Submit validation data