H00284716-B01P

RIMKLA antibody from Abnova Corporation
FAM80A, MGC47816, NAAGS-II, RP11-157D18.1

Antibody data

Product number
H00284716-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00284716-B01P, RRID:AB_1573481
Product name
FAM80A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00284716-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FAM80A protein.
Antigen sequence
MDQIAVTIVGGHLGLQLNQKALTTFPDVVLVRVPT
PSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINK
FWTFQELAGHGVPMPDTFSYGGHEDFSKMIDEAEP
LGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIR
HDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRC
STDGRMQSNCSLGGVGVKCPLTEQGKQLAIQVSNI
LGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQA
CNLDVGGIIADYTMSLLPNRQTGKMAVLPGLSSPR
EKNEPDGCASAQGVAESVYTINSGSTSSESEPELG
EIRDSSASTMGAPPSMLPEPGYNINNRIASELKLK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -