HPA003100

PLXNB2 antibody from Atlas Antibodies
KIAA0315, MM1, PLEXB2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003100
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003100, RRID:AB_1079638
Product name
Anti-PLXNB2
Provider product page
Atlas Antibodies - HPA003100
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSD
QDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYY
DEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -