HPA003100

PLXNB2 antibody from Sigma-Aldrich
KIAA0315, MM1, PLEXB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003100
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003100, RRID:AB_1079638
Product name
Anti-PLXNB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003100
Antibody type
Polyclonal
Antigen
Plexin-B2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSD
QDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYY
DEIINALEEDPAAQKMQLAFRLQQIAAALENKVTD
Storage
-20C
Provider Type Product Number
- No reagents -