Antibody data

Product number
ABIN406673
Provider
antibodies-online
Product name
anti-H2A Histone Family, Member X (H2AFX) (N-Term) antibody
Provider product page
antibodies-online - ABIN406673
Antibody type
Polyclonal
Antigen
The immunogen for anti-H2AFX antibody: synthetic peptide directed towards the N terminal of human H2AFX
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLR
KGHYA ERVGAGAPVY
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -