Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406673 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-H2A Histone Family, Member X (H2AFX) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-H2AFX antibody: synthetic peptide directed towards the N terminal of human H2AFX
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLR
KGHYA ERVGAGAPVY- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references MST1 promotes apoptosis through phosphorylation of histone H2AX.
Accumulation of DSBs in gamma-H2AX domains fuel chromosomal aberrations.
Wen W, Zhu F, Zhang J, Keum YS, Zykova T, Yao K, Peng C, Zheng D, Cho YY, Ma WY, Bode AM, Dong Z
The Journal of biological chemistry 2010 Dec 10;285(50):39108-16
The Journal of biological chemistry 2010 Dec 10;285(50):39108-16
Accumulation of DSBs in gamma-H2AX domains fuel chromosomal aberrations.
Scherthan H, Hieber L, Braselmann H, Meineke V, Zitzelsberger H
Biochemical and biophysical research communications 2008 Jul 11;371(4):694-7
Biochemical and biophysical research communications 2008 Jul 11;371(4):694-7
No comments: Submit comment
No validations: Submit validation data