HPA028638

SNX3 antibody from MilliporeSigma / Merck KGaA
Grd19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028638
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028638, RRID:AB_10604098
Product name
Anti-SNX3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028638
Antibody type
Polyclonal
Antigen
sorting nexin 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERE
SKPCLRMTSEARSHGRTWCAQNDEKL
Storage
-20C
Provider Type Product Number
- No reagents -