H00010951-M01

CBX1 antibody from Abnova Corporation
CBX, HP1-BETA, HP1Hs-beta, M31, MOD1

Antibody data

Product number
H00010951-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010951-M01, RRID:AB_1204068
Product name
CBX1 monoclonal antibody (M01), clone 4E12
Provider product page
Abnova Corporation - H00010951-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CBX1.
Antigen sequence
GKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKV
EYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQ
KTAHETDKSEGGKRKADSDSEDKGEESK
Isotype
IgG
Antibody clone number
4E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -