HPA030155

AFG1L antibody from MilliporeSigma / Merck KGaA
AFG1, LACE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030155
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030155, RRID:AB_10601232
Product name
Anti-LACE1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030155
Antibody type
Polyclonal
Antigen
lactation elevated 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WKAYTVQTSESMTPTATSETYLKALAVCHGPLDHY
DFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIE
AEGLFSKLFSRSKPPRGLYVYGDVGTGK
Storage
-20C
Provider Type Product Number
- No reagents -