Antibody data

Product number
H00149461-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00149461-M02, RRID:AB_1136914
Product name
CLDN19 monoclonal antibody (M02), clone 2F2
Provider product page
Abnova Corporation - H00149461-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CLDN19.
Antigen sequence
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSY
AGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL
LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCT
RVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWY
ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLA
VLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREY
V
Isotype
IgG
Antibody clone number
2F2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -