H00149461-A01

CLDN19 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00149461-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00149461-A01, RRID:AB_1139191
Product name
CLDN19 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00149461-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant CLDN19.
Antigen sequence
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSY
AGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL
LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCT
RVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWY
ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLA
VLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREY
V
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -