Antibody data

Product number
ABIN487101
Provider
antibodies-online
Product name
anti-Claudin 19 (CLDN19) (C-Term) antibody
Provider product page
antibodies-online - ABIN487101
Antibody type
Polyclonal
Antigen
The immunogen for anti-CLDN19 antibody: synthetic peptide directed towards the C terminal of human CLDN19
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAARE
PVVKL PASAKGPLGV
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -