Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064175-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064175-M01, RRID:AB_464274
- Product name
- LEPRE1 monoclonal antibody (M01), clone 3C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LEPRE1.
- Antigen sequence
DPRVREVMNQNLAYYAAMLGEEHTRSIGPRESAKE
YRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVI
PKRLQEKQKSERETAVRISQEIGNLMKEIE- Isotype
- IgG
- Antibody clone number
- 3C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Localization of collagen modifying enzymes on fibroblastic reticular cells and follicular dendritic cells in non-neoplastic and neoplastic lymphoid tissues.
Proteomic dissection of the von Hippel-Lindau (VHL) interactome.
Severe osteogenesis imperfecta in cyclophilin B-deficient mice.
Prolyl 3-hydroxylase 1 deficiency causes a recessive metabolic bone disorder resembling lethal/severe osteogenesis imperfecta.
Ohe R, Aung NY, Meng H, Kabasawa T, Suto A, Tamazawa N, Yang S, Kato T, Yamakawa M
Leukemia & lymphoma 2016 Jul;57(7):1687-96
Leukemia & lymphoma 2016 Jul;57(7):1687-96
Proteomic dissection of the von Hippel-Lindau (VHL) interactome.
Lai Y, Song M, Hakala K, Weintraub ST, Shiio Y
Journal of proteome research 2011 Nov 4;10(11):5175-82
Journal of proteome research 2011 Nov 4;10(11):5175-82
Severe osteogenesis imperfecta in cyclophilin B-deficient mice.
Choi JW, Sutor SL, Lindquist L, Evans GL, Madden BJ, Bergen HR 3rd, Hefferan TE, Yaszemski MJ, Bram RJ
PLoS genetics 2009 Dec;5(12):e1000750
PLoS genetics 2009 Dec;5(12):e1000750
Prolyl 3-hydroxylase 1 deficiency causes a recessive metabolic bone disorder resembling lethal/severe osteogenesis imperfecta.
Cabral WA, Chang W, Barnes AM, Weis M, Scott MA, Leikin S, Makareeva E, Kuznetsova NV, Rosenbaum KN, Tifft CJ, Bulas DI, Kozma C, Smith PA, Eyre DR, Marini JC
Nature genetics 2007 Mar;39(3):359-65
Nature genetics 2007 Mar;39(3):359-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LEPRE1 monoclonal antibody (M01), clone 3C7 Western Blot analysis of LEPRE1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of LEPRE1 expression in transfected 293T cell line by LEPRE1 monoclonal antibody (M01), clone 3C7.Lane 1: LEPRE1 transfected lysate(46 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LEPRE1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to LEPRE1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to LEPRE1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol