H00064175-B01P

P3H1 antibody from Abnova Corporation
GROS1, LEPRE1, LEPRECAN, MGC117314

Antibody data

Product number
H00064175-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064175-B01P, RRID:AB_1137611
Product name
LEPRE1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00064175-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LEPRE1 protein.
Antigen sequence
MLGEEHTRSIGPRESAKEYRQRSLLEKELLFFAYD
VFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVR
ISQEIGNLMKEIETLVEEKTKESLDVSRLTREGGP
LLYEGISLTMNSKLLNGSQRVVMDGVISDHECQEL
QRLTNVAATSGDGYRGQTSPHTPNEKFYGVTVFKA
LKLGQEGKVPLQSAHLYYNVTEKVRRIMESYFRLD
TPLYFSYSHLVCRTAIEEVQAERKDDSHPVHVDNC
ILNAETLVCVKEPPAYTFRDYSAILYLNGDFDGGN
FYFTELDAKTVTAEVQPQCGRAVGFSSGTENPHGV
KAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKM
LFSPEEMDLSQEQPLDAQQGPPEPAQESLSGSESK
PKDEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -