H00025996-M01

REXO2 antibody from Abnova Corporation
CGI-114, DKFZP566E144, SFN

Antibody data

Product number
H00025996-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025996-M01, RRID:AB_1237849
Product name
REXO2 monoclonal antibody (M01), clone 2B5
Provider product page
Abnova Corporation - H00025996-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant REXO2.
Antigen sequence
HGRSGLTKAVKESTITLQQAEYEFLSFVRQQTPPG
LCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVS
TVKELCRRWYPEEYEFAPKKAASHRALDDISESIK
ELQFY
Isotype
IgG
Antibody clone number
2B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -