H00023705-M09

CADM1 antibody from Abnova Corporation
BL2, IGSF4, IGSF4A, Necl-2, NECL2, RA175, ST17, SYNCAM, SYNCAM1, TSLC1
No application information provided.

Antibody data

Product number
H00023705-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023705-M09, RRID:AB_1572648
Product name
CADM1 monoclonal antibody (M09), clone 3F6
Provider product page
Abnova Corporation - H00023705-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CADM1.
Antigen sequence
IQRDTAVEGEEIEVNCTAMASKPATTIRWFKGNTE
LKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVIC
QVEHPAVTGNLQTQRYLEVQYKPQVHIQMT
Isotype
IgG
Antibody clone number
3F6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -