H00064780-B01P

MICAL1 antibody from Abnova Corporation
DKFZp434B1517, FLJ11937, FLJ21739, MICAL, NICAL

Antibody data

Product number
H00064780-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064780-B01P, RRID:AB_1577282
Product name
MICAL1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00064780-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MICAL1 protein.
Antigen sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCG
ALGLEPGGGLPQYHKIKDQLNYWSAKSLWTKLDKR
AGQPVYQQGRACTSTKCLVVGAGPCGLRVAVELAL
LGARVVLVEKRTKFSRHNVLHLWPFTIHDLRALGA
KKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEI
HWGVTFTGLQPPPRKGSGWRAQLQPNPPAQLANYE
FDVLISAAGGKFVPEGFKVREMRGKLAIGITANFV
NGRTVEETQVPEISGVARIYNQSFFQSLLKATGID
LENIVYYKDDTHYFVMTAKKQCLLRLGVLRQPFWP
LGTGVARGFLAAFDAAWMVKRWAEGAESLEVLAER
ESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNL
RAVTPNQVRDLYDVLAKEPVQRNNDKTDTGMPATG
SAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGL
ALCALVYRLQPGLLEPSELQGLGALEATAWALKVA
ENELGITPVVSAQAVVAGSDPLGLIAYLSHFHSAF
KSMAHSPGPVSQTSPGTSSAVLFLSKLQRTLQRSR
AKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVP
LTPPSQHQEAGAGDLCALCGEHLYVLERLCVNGHF
FHRSCFRCHTCEATLWPGGYEQHPGDGHFYCLQHL
PQTDHKKEGSDRGPESPELPTPSENSMPPGLSTPT
ASQEGAGPVPDPSQPTRRQIRLSSPERQRLSSLNL
TPDPEMEPPPKPPRSCSALARHALESSFVGWGLPV
QSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQ
ALQTFAKTSGTMNNYPTWRRTLLRRAKEEEMKRFC
KAQTIQRRLNEIEAALRELEAEGVKLELALRRQSS
SPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQ
ELNLEEKQWQLDQELRGYMNREENLKTAADRQAED
QVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQ
G
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -