HPA018127

NAV1 antibody from Sigma-Aldrich
DKFZp781D0314, FLJ12560, FLJ14203, KIAA1151, MGC14961, POMFIL3, steerin-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018127
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018127, RRID:AB_1854317
Product name
Anti-NAV1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018127
Antibody type
Polyclonal
Antigen
Neuron navigator 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RETMHNMQLEVDLLKAENDRLKVAPGPSSGSTPGQ
VPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMD
GISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFF
LGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPAST
LGLSTESIH
Storage
-20C
Provider Type Product Number
- No reagents -