Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003021-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003021-M01, RRID:AB_425473
- Product name
- H3F3B monoclonal antibody (M01), clone 2D7-H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant H3F3B.
- Antigen sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGG
VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLF
EDTNLCAIHAKRVTIMPKDIQLARRIRGERA- Isotype
- IgG
- Antibody clone number
- 2D7-H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation.
Chromatin and transcription transitions of mammalian adult germline stem cells and spermatogenesis.
Drosophila Yemanuclein and HIRA cooperate for de novo assembly of H3.3-containing nucleosomes in the male pronucleus.
Histone variant H3.3 maintains a decondensed chromatin state essential for mouse preimplantation development.
HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes.
The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3.
Pradhan SK, Su T, Yen L, Jacquet K, Huang C, Côté J, Kurdistani SK, Carey MF
Molecular cell 2016 Jan 7;61(1):27-38
Molecular cell 2016 Jan 7;61(1):27-38
Chromatin and transcription transitions of mammalian adult germline stem cells and spermatogenesis.
Hammoud SS, Low DH, Yi C, Carrell DT, Guccione E, Cairns BR
Cell stem cell 2014 Aug 7;15(2):239-53
Cell stem cell 2014 Aug 7;15(2):239-53
Drosophila Yemanuclein and HIRA cooperate for de novo assembly of H3.3-containing nucleosomes in the male pronucleus.
Orsi GA, Algazeery A, Meyer RE, Capri M, Sapey-Triomphe LM, Horard B, Gruffat H, Couble P, Aït-Ahmed O, Loppin B
PLoS genetics 2013;9(2):e1003285
PLoS genetics 2013;9(2):e1003285
Histone variant H3.3 maintains a decondensed chromatin state essential for mouse preimplantation development.
Lin CJ, Conti M, Ramalho-Santos M
Development (Cambridge, England) 2013 Sep;140(17):3624-34
Development (Cambridge, England) 2013 Sep;140(17):3624-34
HIRA dependent H3.3 deposition is required for transcriptional reprogramming following nuclear transfer to Xenopus oocytes.
Jullien J, Astrand C, Szenker E, Garrett N, Almouzni G, Gurdon JB
Epigenetics & chromatin 2012 Oct 29;5(1):17
Epigenetics & chromatin 2012 Oct 29;5(1):17
The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3.
Drané P, Ouararhni K, Depaux A, Shuaib M, Hamiche A
Genes & development 2010 Jun 15;24(12):1253-65
Genes & development 2010 Jun 15;24(12):1253-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of H3F3B expression in transfected 293T cell line by H3F3B monoclonal antibody (M01), clone 2D7-H1.Lane 1: H3F3B transfected lysate(15 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged H3F3B is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to H3F3B on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to H3F3B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
