Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023636 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023636, RRID:AB_10601774
- Product name
- Anti-UNK
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DAWKKEAEEAGERASAAGAECELAREQRDALEVQV
KKLQEELERLHAGPEPQALPAFSDLEALSLSTLYS
LQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Recognition of distinct RNA motifs by the clustered CCCH zinc fingers of neuronal protein Unkempt.
Control of a neuronal morphology program by an RNA-binding zinc finger protein, Unkempt.
Murn J, Teplova M, Zarnack K, Shi Y, Patel DJ
Nature structural & molecular biology 2016 Jan;23(1):16-23
Nature structural & molecular biology 2016 Jan;23(1):16-23
Control of a neuronal morphology program by an RNA-binding zinc finger protein, Unkempt.
Murn J, Zarnack K, Yang YJ, Durak O, Murphy EA, Cheloufi S, Gonzalez DM, Teplova M, Curk T, Zuber J, Patel DJ, Ule J, Luscombe NM, Tsai LH, Walsh CA, Shi Y
Genes & development 2015 Mar 1;29(5):501-12
Genes & development 2015 Mar 1;29(5):501-12
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN