HPA027962

UNK antibody from Sigma-Aldrich
KIAA1753, ZC3H5, ZC3HDC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027962
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027962, RRID:AB_10611522
Product name
Anti-UNK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027962
Antibody type
Polyclonal
Antigen
unkempt homolog (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDD
LQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPH
APDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLE
GIVFPGES
Storage
-20C
Provider Type Product Number
- No reagents -