Antibody data

Product number
H00201294-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00201294-M05, RRID:AB_1137524
Product name
UNC13D monoclonal antibody (M05), clone 2C7
Provider product page
Abnova Corporation - H00201294-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant UNC13D.
Antigen sequence
ATLLSHPQQRPPFLRQAIKIRRRRVRDLQDPPPQM
APEIQPPSHHFSPEQRALLYEDALYTVLHRLGHPE
PNHVTEASELLRYLQEAFHVEPEEHQQTL
Isotype
IgG
Antibody clone number
2C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -