Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023558-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023558-M02, RRID:AB_1137073
- Product name
- WBP2 monoclonal antibody (M02), clone 3B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant WBP2.
- Antigen sequence
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDM
KNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSF
MMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWE
GSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPS
GAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPP
PPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSG
PDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTS
QPPPPPYYPPEDKKTQ- Isotype
- IgG
- Antibody clone number
- 3B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Tyrosine phosphorylation of transcriptional coactivator WW-domain binding protein 2 regulates estrogen receptor α function in breast cancer via the Wnt pathway.
WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ.
Lim SK, Orhant-Prioux M, Toy W, Tan KY, Lim YP
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Sep;25(9):3004-18
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Sep;25(9):3004-18
WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ.
Chan SW, Lim CJ, Huang C, Chong YF, Gunaratne HJ, Hogue KA, Blackstock WP, Harvey KF, Hong W
Oncogene 2011 Feb 3;30(5):600-10
Oncogene 2011 Feb 3;30(5):600-10
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of WBP2 expression in transfected 293T cell line by WBP2 monoclonal antibody (M02), clone 3B1.Lane 1: WBP2 transfected lysate (Predicted MW: 28.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to WBP2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol