HPA014933

TRIM47 antibody from Sigma-Aldrich
GOA, RNF100
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014933
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014933, RRID:AB_10603219
Product name
Anti-TRIM47 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014933
Antibody type
Polyclonal
Antigen
tripartite motif-containing 47 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEA
PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLR
RLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHR
LK
Storage
-20C
Provider Type Product Number
- No reagents -