HPA021924

DGKI antibody from Sigma-Aldrich
DGK-IOTA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021924, RRID:AB_10601209
Product name
Anti-DGKI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021924
Antibody type
Polyclonal
Antigen
diacylglycerol kinase, iota recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRVNKISLQDYEGFHYDKEKLREASIPLGILVVRG
DCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHET
Storage
-20C
Provider Type Product Number
- No reagents -