HPA028974

ZNF514 antibody from MilliporeSigma / Merck KGaA
FLJ14457
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028974
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028974, RRID:AB_10603845
Product name
Anti-ZNF514 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028974
Antibody type
Polyclonal
Antigen
zinc finger protein 514 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQKDLYREVMLENFRNLAILGLLVSKPYVICQLEE
GGEPFMVEREISTGAHSDWKRRSKSKESMPSWGIS
KEELFQVVSVEKHIQDVLQFSKLKAACGCDGQLEM
QQIKQERHLKQM
Storage
-20C
Provider Type Product Number
- No reagents -