Antibody data

Product number
H00005049-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005049-M01A, RRID:AB_1204756
Product name
PAFAH1B2 monoclonal antibody (M01A), clone 2F4-1C10
Provider product page
Abnova Corporation - H00005049-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PAFAH1B2.
Antigen sequence
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDC
KDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN
FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTN
NHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL
PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDT
DGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH
ELIMQLLEETPEEKQTTIA
Isotype
IgM
Antibody clone number
2F4-1C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -