Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006718-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006718-M01, RRID:AB_10549007
- Product name
- AKR1D1 monoclonal antibody (M01), clone 1A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AKR1D1.
- Antigen sequence
NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLR
FNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEM
KDIEALNKNVRFVELLMWRDHPEYPFHDEY- Isotype
- IgG
- Antibody clone number
- 1A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AKR1D1 expression in transfected 293T cell line by AKR1D1 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1D1 transfected lysate(37.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of AKR1D1 transfected lysate using anti-AKR1D1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AKR1D1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol