H00080007-B01

C10orf88 antibody from Abnova Corporation
Em:AC073585.5, FLJ13490

Antibody data

Product number
H00080007-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080007-B01, RRID:AB_1204020
Product name
C10orf88 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00080007-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C10orf88 protein.
Antigen sequence
METRTEDGGLTRRPTLASSWDVAGGALTHSLLLTR
AGLGPGDFDWEELLAPPAPGQDLVILKRNHNNKDE
NPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGE
EYCGTSRGKNVCTVLDDSEHEKIILYKKNLKLESS
THACKIKLLSFGERQCVFISKVVVHMRSVFANSST
SSPALGSRIDLDKVQTIMESMGSKLSPGAQQLMDM
VRCQQRNCIPIGEQLQSVLGNSGYKHMIGLQSSST
LGTLNKSSSTPFPFRTGLTSGNVTENLQTYIDKST
QLPGGENSTKLDECKVMPQNHSFLENDLKNAMASF
LPKKVSDNSNIPNSELLPFLQNLCSQVNHLHVGNK
TECQENITKHGERILGVGMEEQSICSYLEKILSKN
MELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQ
NPNSPPTGIPLRHYDSGERLSNGER
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -