HPA028377

MED8 antibody from Sigma-Aldrich
ARC32, MGC17544, MGC19641
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028377
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028377, RRID:AB_10600112
Product name
Anti-MED8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028377
Antibody type
Polyclonal
Antigen
mediator complex subunit 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHL
RTKPDPEVEEQEKQLTTDAARIGADAAQKQ
Storage
-20C
Provider Type Product Number
- No reagents -