H00023334-B01

SZT2 antibody from Abnova Corporation
C1orf84, FLJ10387, FLJ34502, KIAA0467, RP11-506B15.1, SZT2A, SZT2B

Antibody data

Product number
H00023334-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023334-B01, RRID:AB_1138488
Product name
KIAA0467 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023334-B01
Antibody type
Polyclonal
Antigen
KIAA0467 (AAH52802, 1 a.a. ~ 579 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MLFDPAAWLHGPPETSGPPDGQRRHRPESGSGSRE
APTSCESLDVSPPGAREEPWLKELSLAFLQQYVQY
LQSIGFVLVPLRPPSPARSTSRPRAMAILGTEGRG
SFSCPKTKTDGSPKSTSSPVTTYHLQRALPGGIIL
MELAFQGCYFCVKQFALECSRIPMGQAVNSQLSML
FTEECDKVRDLMHVHSFSYDFHLRLVHQHVLGAHL
VLRHGYHLTTFLRHFLAHHPDGPHFGRNHIYQGTL
ELPTPLIAAHQLYNYVADHASSYHMKPLRMARPGG
PEHNEYALVSAWHSSGSYLDSEGLRHQDDFDVSLL
VCHCAAPFEEQGEAERHVLRLQFFVVLTSQRELFP
RLTADMRRFRKPPRLPPEPEAPGSSAGSPGEASGL
ILAPGPAPLFPPLAAEVGMARARLAQLVRLAGGHC
RRDTLWKRLFLLEPPGPDRLRLGGRLALAELEELL
EAVHAKSIGDIDPQLDCFLSMTVSWYQSLIKVLLS
RFPQSCRHFQSPDLGTQYLVVLNQKFTDCFVLVFL
DSHLGKTSLTVVFREPFPVQPQDSESPPAQLVSTY
HHLESVINTACFTLWTRLL
Vial size
50 µl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -