Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011253-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011253-M01, RRID:AB_518886
- Product name
- MAN1B1 monoclonal antibody (M01), clone 6B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAN1B1.
- Antigen sequence
AFRLEEEQKMRPEIAGLKPANPPVLPAPQKADTDP
ENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGT
QEEATKRQEAPVDPRPEGDPQRTVISWRGA- Isotype
- IgG
- Antibody clone number
- 6B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAN1B1 monoclonal antibody (M01), clone 6B1. Western Blot analysis of MAN1B1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAN1B1 monoclonal antibody (M01), clone 6B1. Western Blot analysis of MAN1B1 expression in LNCaP ( Cat # L004V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MAN1B1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MAN1B1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol