Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA037605 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA037605, RRID:AB_10672908
- Product name
- Anti-CEP164
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DYDETYIPSEQEILEFAREIGIDPIKEPELMWLAR
EGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDH
PCDEHYRSLVIQERAKLSTSG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming
The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base
ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting
Wu C, Lidsky P, Xiao Y, Cheng R, Lee I, Nakayama T, Jiang S, He W, Demeter J, Knight M, Turn R, Rojas-Hernandez L, Ye C, Chiem K, Shon J, Martinez-Sobrido L, Bertozzi C, Nolan G, Nayak J, Milla C, Andino R, Jackson P
Cell 2023;186(1):112-130.e20
Cell 2023;186(1):112-130.e20
The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base
Kanie T, Abbott K, Mooney N, Plowey E, Demeter J, Jackson P
Developmental Cell 2017;42(1):22-36.e12
Developmental Cell 2017;42(1):22-36.e12
ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting
Humbert M, Weihbrecht K, Searby C, Li Y, Pope R, Sheffield V, Seo S
Proceedings of the National Academy of Sciences 2012;109(48):19691-19696
Proceedings of the National Academy of Sciences 2012;109(48):19691-19696
No comments: Submit comment
No validations: Submit validation data