Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA037605 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA037605, RRID:AB_10672908
- Product name
- Anti-CEP164
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DYDETYIPSEQEILEFAREIGIDPIKEPELMWLAR
EGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDH
PCDEHYRSLVIQERAKLSTSG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
Humbert MC, Weihbrecht K, Searby CC, Li Y, Pope RM, Sheffield VC, Seo S
Proceedings of the National Academy of Sciences of the United States of America 2012 Nov 27;109(48):19691-6
Proceedings of the National Academy of Sciences of the United States of America 2012 Nov 27;109(48):19691-6
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows cytoplasmic and membranous positivity in cells in tubules.