HPA029417

HHLA2 antibody from MilliporeSigma / Merck KGaA
B7-H5, B7H7, B7y
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029417
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029417, RRID:AB_10602604
Product name
Anti-HHLA2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029417
Antibody type
Polyclonal
Antigen
HERV-H LTR-associating 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INSPLNITGSNSSYECTIENSLLKQTWTGRWTMKD
GLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMK
SGTFSVLAYYLSSSQNTIINESRFSWNKELINQSD
FSMNLMDLNLSDSGEYLCNISSDEYTLLT
Storage
-20C
Provider Type Product Number
- No reagents -