Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005980-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005980-A01, RRID:AB_875819
- Product name
- REV3L polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant REV3L.
- Antigen sequence
GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVA
VILNQEIRELERQQEQLVKICKNCTGCFDRHIPCV
SLNCPVLFKLSRVNRELSKAPYLRQLLDQF- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references REV3L, the catalytic subunit of DNA polymerase ΞΆ, is involved in the progression and chemoresistance of esophageal squamous cell carcinoma.
REV3L 3'UTR 460 T>C polymorphism in microRNA target sites contributes to lung cancer susceptibility.
Zhu X, Zou S, Zhou J, Zhu H, Zhang S, Shang Z, Ding WQ, Wu J, Chen Y
Oncology reports 2016 Mar;35(3):1664-70
Oncology reports 2016 Mar;35(3):1664-70
REV3L 3'UTR 460 T>C polymorphism in microRNA target sites contributes to lung cancer susceptibility.
Zhang S, Chen H, Zhao X, Cao J, Tong J, Lu J, Wu W, Shen H, Wei Q, Lu D
Oncogene 2013 Jan 10;32(2):242-50
Oncogene 2013 Jan 10;32(2):242-50
No comments: Submit comment
No validations: Submit validation data