Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310840 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ST3GAL3 antibody: synthetic peptide directed towards the N terminal of human ST3GAL3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGI
KGQDN LIKAILSVTK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Structure-function analysis of the human sialyltransferase ST3Gal I: role of n-glycosylation and a novel conserved sialylmotif.
Jeanneau C, Chazalet V, Augé C, Soumpasis DM, Harduin-Lepers A, Delannoy P, Imberty A, Breton C
The Journal of biological chemistry 2004 Apr 2;279(14):13461-8
The Journal of biological chemistry 2004 Apr 2;279(14):13461-8
No comments: Submit comment
No validations: Submit validation data