HPA035066

DZIP3 antibody from MilliporeSigma / Merck KGaA
hRUL138, PPP1R66
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035066
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035066, RRID:AB_10601549
Product name
Anti-DZIP3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035066
Antibody type
Polyclonal
Antigen
DAZ interacting protein 3, zinc finger recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLC
LLLALIKHLNVFPAPKKGWNMEPPSSDISKSADIL
RLCKYRDILLSEILMNGLTESQFNSIWK
Storage
-20C
Provider Type Product Number
- No reagents -