PAB15694

antibody from Abnova Corporation

Targeting: XPO5 KIAA1291

No application information provided.

Antibody Data

Product number

PAB15694

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#PAB15694, RRID:AB_10678997

Product name

Xpo5 polyclonal antibody

Antibody type

Polyclonal

Description

Rabbit polyclonal antibody raised against partial recombinant Xpo5.

Antigen sequence

AFQIYEALRPRYLEIRAVMEQIPEINKESLDQFDC
KLLNPSLQKAADKRRKDHFKRLIAGCIGKPLGEQF
RKEVHIKNLPWLFKKPKPMLETEVLDSEEGGLATI
FEP


Storage

Store at -20°C.Aliquot to avoid repeated freezing and thawing.

References

Submitted references

A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.

Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304

---

High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.

Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36

---

Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.

Bohnsack MT, Regener K, Schwappach B, Saffrich R, Paraskeva E, Hartmann E, Görlich D
The EMBO journal 2002 Nov 15;21(22):6205-15