Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000486-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000486-M01, RRID:AB_425318
- Product name
- FXYD2 monoclonal antibody (M01), clone 1C3-B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FXYD2.
- Antigen sequence
MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLA
FIVGLLILLSRRFRCGGNKKRRQINEDEP- Isotype
- IgG
- Antibody clone number
- 1C3-B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A genomic-based approach identifies FXYD domain containing ion transport regulator 2 (FXYD2)gammaa as a pancreatic beta cell-specific biomarker.
Flamez D, Roland I, Berton A, Kutlu B, Dufrane D, Beckers MC, De Waele E, Rooman I, Bouwens L, Clark A, Lonneux M, Jamar JF, Goldman S, Maréchal D, Goodman N, Gianello P, Van Huffel C, Salmon I, Eizirik DL
Diabetologia 2010 Jul;53(7):1372-83
Diabetologia 2010 Jul;53(7):1372-83
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FXYD2 monoclonal antibody (M01), clone 1C3-B3 Western Blot analysis of FXYD2 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FXYD2 is 0.3 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol